PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_13905_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 307aa    MW: 34472.6 Da    PI: 5.3951
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_13905_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding31.44.5e-101647132
                                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
                       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg 32
                                          +g+WT+eEd++l+++++q G g+W++ +++ g
  cra_locus_13905_iso_1_len_1000_ver_3 16 KGPWTKEEDDILINYINQNGHGNWRALPKKAG 47
                                          79**************************9988 PP

2Myb_DNA-binding50.74.2e-16104149148
                                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                           rg++++eE++ ++++++ lG++ W++Ia++++ gRt++++k+ w+++l
  cra_locus_13905_iso_1_len_1000_ver_3 104 RGNFSKEEEDTIIHLHHALGNR-WSAIAARLP-GRTDNEIKNVWHTHL 149
                                           89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.9E-23746IPR009057Homeodomain-like
SuperFamilySSF466893.24E-81046IPR009057Homeodomain-like
PROSITE profilePS512949.9221158IPR017930Myb domain
SMARTSM007175.7E-915100IPR001005SANT/Myb domain
PfamPF002496.6E-81648IPR001005SANT/Myb domain
CDDcd001671.19E-61898No hitNo description
Gene3DG3DSA:1.10.10.603.9E-2381101IPR009057Homeodomain-like
SuperFamilySSF466898.77E-2185156IPR009057Homeodomain-like
PROSITE profilePS5129425.05999153IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-26102154IPR009057Homeodomain-like
SMARTSM007172.1E-14103151IPR001005SANT/Myb domain
PfamPF002492.9E-15104149IPR001005SANT/Myb domain
CDDcd001675.86E-10106149No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
XEMGRAPCCE KMGLKKGPWT KEEDDILINY INQNGHGNWR ALPKKAGTFL IXYMPAFSDS  60
RAEVVIXLVV AKINGGFNQS TGLLRCGKSC RLRWTNYLRP DIKRGNFSKE EEDTIIHLHH  120
ALGNRWSAIA ARLPGRTDNE IKNVWHTHLK KKLVKQSAIP DPQISETPRP AKLDQYRHET  180
AGGEDSIRSS LSTEMSIHDQ SNSPPHSSSS SNDDVSSSNI TTSCTSNSNT TENDAEMSCL  240
LLNNLNEDFW LDLDFVSCEN SWKFIGGEDV GDYCNSSFII NNSSSISDDD INFWSDPFPR  300
AEELPQF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-21141535108B-MYB
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154